PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g11370.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 556aa    MW: 61700.7 Da    PI: 4.4664
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g11370.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-16267311147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
   Vang03g11370.2 267 RERWTDEEHKKFLEALKLHGRA-WRRIEEHVG-TKTAVQIRSHAQKF 311
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.24E-16261314IPR009057Homeodomain-like
PROSITE profilePS5129421.174262316IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-9264314IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-15265314IPR006447Myb domain, plants
SMARTSM007175.3E-13266314IPR001005SANT/Myb domain
PfamPF002491.0E-13267310IPR001005SANT/Myb domain
CDDcd001676.71E-10269312No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MDEDIEVVFH HGGKLVNDGK LKYEGGETSR FMFDPDVWSY FVVVSVVKSL GYHGLKDMWY  60
FVGGASVLDD KLEPLCDDTG DMHMVNLARL NGEVHVFFIH PVSEPDVIHM LEYVGNDEGQ  120
VEERGDVDCE EVEVDAVMEE XVVRVEEVGG VLEEMGNVDG EEQEMGEQVL VEAVMEEEVV  180
RVEEVCGVLE EIGEQVEVEA VMEEEVDGVE EDQNGFNRSQ DDPSVGSGVS LSSGVHSAPH  240
IQLNDQFSCG SDYALKVRKP YTITKQRERW TDEEHKKFLE ALKLHGRAWR RIEEHVGTKT  300
AVQIRSHAQK FFSKVLRDPT GNVTNRAESI EIPPPRPKRK PMHPYPRKLV ETPNKETSIP  360
EQLMKSGSLK SSDFDQENQS PKSVLSGAGS DILSSSDSDT PNESLSPVSS ISDIHTTSEE  420
AGINADSSHD EKSLMKLKLP TKESVFIKEE SSGQTLKLFG ITLFVTDTCK PSSPRTEACK  480
PIPLNICKGD GRLELIGHIT PSETSAISLL KMREGPETCD GKGFVPYRRC MAGRENQSSS  540
VTNDNREEQC IHLSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517129.10.0PREDICTED: protein REVEILLE 2-like
RefseqXP_014517128.10.0PREDICTED: protein REVEILLE 2-like
TrEMBLA0A0S3S5M10.0A0A0S3S5M1_PHAAN; Uncharacterized protein
STRINGGLYMA18G05050.11e-169(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.14e-54MYB_related family protein